PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo15G0027100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 156aa    MW: 17847.5 Da    PI: 10.3206
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo15G0027100genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.5e-181057148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd ll ++v q+G g+W++I+++ g++R++k+c++rw++yl
  Spipo15G0027100 10 KGAWTPEEDILLQRCVLQYGEGQWHLIPERAGLRRCRKSCRLRWLNYL 57
                     79********************************************97 PP

2Myb_DNA-binding47.34.8e-1563107147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++ ++E +l+v+++++lG++ W++Ia +++ gRt++++k++w++ 
  Spipo15G0027100  63 RGAFQEDEVDLIVRLHRLLGNR-WSLIAGRIP-GRTANDIKNYWNSC 107
                      899*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.496161IPR017930Myb domain
SuperFamilySSF466891.61E-278104IPR009057Homeodomain-like
SMARTSM007171.6E-14959IPR001005SANT/Myb domain
PfamPF002497.1E-171057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-221164IPR009057Homeodomain-like
CDDcd001672.93E-101257No hitNo description
PROSITE profilePS5129418.17462112IPR017930Myb domain
SMARTSM007171.6E-1062110IPR001005SANT/Myb domain
PfamPF002498.4E-1463107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2265111IPR009057Homeodomain-like
CDDcd001671.73E-868105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MENQVAKVRK GAWTPEEDIL LQRCVLQYGE GQWHLIPERA GLRRCRKSCR LRWLNYLKPS  60
IKRGAFQEDE VDLIVRLHRL LGNRWSLIAG RIPGRTANDI KNYWNSCLCK KVGAQGKVVR  120
KINNRSTVGL AAETYNSWWE DILLDANPTS GTWSG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-25101127108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010064838.11e-58PREDICTED: transcription factor MYB114-like
SwissprotQ9FNV98e-55MY113_ARATH; Transcription factor MYB113
TrEMBLB7SJG54e-59B7SJG5_DIPAU; R2R3 MYB transcriptional regulator
TrEMBLW8EB732e-58W8EB73_ERYLE; Anthocyanin-activating R2R3 MYB transcription factor
STRINGSolyc10g086260.1.15e-57(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.15e-56myb domain protein 113